| Desktop | 91/100 | ✔ |
| Mobile | 52/100 | ❗ |
| Field | Data | Result |
|---|---|---|
| Page Size | 41 KB | ✔ |
| Compression | 9 KB (-77.9%) | ✔ |
| Text/Html Ratio | 3159 / 41569 (bytes) = 7.6% | ❗ |
| Load Time | 0.53 second | ✔ |
| Mobile Ready | 0/100 | ✘ |
| In-Page Links | 39 | ✔ |
| Doc Type | HTML 5 | ✔ |
| Encoding | UTF-8 | ✔ |
| Declared Language | English | ✔ |
| Preferred Domain | Yes | ✔ |
| Robots.txt | No | ✘ |
| Url Rewrite | Yes | ✘ |
| Underscores in url | No | ✔ | Images Without ALT | 6 / 27 | ✘ |
| Embedded Objects (Desktop) | No | ✔ |
| Embedded Objects (Mobile) | No | ✔ |
| Iframe | No | ✔ |
| Custom 404 page | No | ✘ |
| Email Privacy | No | ✘ |
| Gsafe browsing | Yes | ✔ |
| Analytics | No | ✘ |
| W3C Validity | No | ✘ |
| Keywords | Freq | Title | Desc | <H> |
|---|---|---|---|---|
| credit | 7 | ✘ | ✔ | ✘ |
| more | 5 | ✘ | ✘ | ✘ |
| commercial | 5 | ✘ | ✘ | ✘ |
| ------------------------- | 5 | ✘ | ✘ | ✘ |
| banking | 4 | ✔ | ✔ | ✘ |
| services | 4 | ✘ | ✔ | ✘ |
| mortgage | 4 | ✔ | ✔ | ✘ |
| bank | 4 | ✔ | ✔ | ✘ |
| best | 3 | ✘ | ✘ | ✘ |
| help | 3 | ✘ | ✘ | ✘ |
| account | 3 | ✘ | ✘ | ✘ |
| cards | 3 | ✘ | ✔ | ✘ |
| checking | 3 | ✘ | ✘ | ✘ |
| about | 3 | ✘ | ✘ | ✘ |
| oojd | 3 | ✔ | ✘ | ✘ |
|
With 0.53 seconds in page load, 41 KB of page size and all other reports below, the oojdb.com has a SEO score of 54 out of 100 |
| Title | Oscar Onome James Dire Bank|Mortgage, Banking, Auto oojdbank.com |
| Description | We're proud to serve nearly half of America’s households with a broad range of financial services, including personal banking, credit cards, mortgages, auto financing, investment advice... |
| Keyword | OOJDB.com, Oscar Onome James Dire Bank, Checking Account, Savings Account, Diaspora Account, Offshore Account, Salary Account, Child DEP |
| Age | 0 Years, 8 Days |
| Created | 30th-Aug-2022 |
| Updated | 30th-Aug-2022 |
| Expiry | 30th-Aug-2023 |
| Host | Type | Ttl | Other |
|---|---|---|---|
| oojdb.com | A | 1171 | ip:198.54.115.216 |
| oojdb.com | NS | 172771 | target:dns1.namecheaphosting.com |
| oojdb.com | NS | 172771 | target:dns2.namecheaphosting.com |
| oojdb.com | SOA | 604800 | mname:dns1.namecheaphosting.comrname:cpanel.tech.namecheap.comserial:1661843254refresh:86400retry:7200expire:3600000minimum-ttl:86400 |
| oojdb.com | MX | 1200 | pri:20target:mx3-hosting.jellyfish.systems |
| oojdb.com | MX | 1200 | pri:5target:mx1-hosting.jellyfish.systems |
| oojdb.com | MX | 1200 | pri:10target:mx2-hosting.jellyfish.systems |
| oojdb.com | TXT | 1200 | txt:v=spf1 +a +mx +ip4:198.54.114.88 include:spf.web-hosting.com ~all |
|
Domain name: oojdb.com Registry Domain ID: 2721866596_DOMAIN_COM-VRSN Registrar WHOIS Server: whois.namecheap.com Registrar URL: http://www.namecheap.com Updated Date: 0001-01-01T00:00:00.00Z Creation Date: 2022-08-30T07:03:08.00Z Registrar Registration Expiration Date: 2023-08-30T07:03:08.00Z Registrar: NAMECHEAP INC Registrar IANA ID: 1068 Registrar Abuse Contact Email: abuse@namecheap.com Registrar Abuse Contact Phone: +1.9854014545 Reseller: NAMECHEAP INC Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited Registry Registrant ID: Registrant Name: Redacted for Privacy Registrant Organization: Privacy service provided by Withheld for Privacy ehf Registrant Street: Kalkofnsvegur 2 Registrant City: Reykjavik Registrant State/Province: Capital Region Registrant Postal Code: 101 Registrant Country: IS Registrant Phone: +354.4212434 Registrant Phone Ext: Registrant Fax: Registrant Fax Ext: Registrant Email: 8a78d682fded46f4936ec0831d48a27b.protect@withheldforprivacy.com Registry Admin ID: Admin Name: Redacted for Privacy Admin Organization: Privacy service provided by Withheld for Privacy ehf Admin Street: Kalkofnsvegur 2 Admin City: Reykjavik Admin State/Province: Capital Region Admin Postal Code: 101 Admin Country: IS Admin Phone: +354.4212434 Admin Phone Ext: Admin Fax: Admin Fax Ext: Admin Email: 8a78d682fded46f4936ec0831d48a27b.protect@withheldforprivacy.com Registry Tech ID: Tech Name: Redacted for Privacy Tech Organization: Privacy service provided by Withheld for Privacy ehf Tech Street: Kalkofnsvegur 2 Tech City: Reykjavik Tech State/Province: Capital Region Tech Postal Code: 101 Tech Country: IS Tech Phone: +354.4212434 Tech Phone Ext: Tech Fax: Tech Fax Ext: Tech Email: 8a78d682fded46f4936ec0831d48a27b.protect@withheldforprivacy.com Name Server: dns1.namecheaphosting.com Name Server: dns2.namecheaphosting.com DNSSEC: unsigned URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/ >>> Last update of WHOIS database: 2022-09-07T05:06:55.35Z |
| Server IP | 198.54.115.216 |
| Server Location | United States of America |
| Service Provider | NAMECHEAP-NET |
| Domains (TLD) | Status |
|---|---|
| oojdb.net | Available |
| oojdb.org | Already Registered |
| oojdb.biz | Already Registered |
| oojdb.io | Already Registered |
| oojdb.info | Already Registered |
| Domains (TLD) | Status |
|---|---|
| ojdb.com | Already Registered |
| iojdb.com | Available |
| kojdb.com | Available |
| lojdb.com | Available |
| pojdb.com | Available |
| Lendersfast.com |
| Yku3.xyz |
| Ochofoodgroup.com |
| Jpeasun.com |
| Expertreliable.com |
| Wixamscatsitters.co.uk |
| Babyaliz.com |
| Qwertyuo.com |
| Ausablevalleygrangefarmersmarkets.com |
| Do3t.ir |